Germany
Japan
United Kingdom
China
Dynein heavy chain (DNAH9) Rabbit Polyclonal Antibody
Product Images
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "Dynein heavy chain"
Specifications
| Product Data | |
| Applications | IF, WB |
| Recommended Dilution | IF, WB |
| Reactivities | Mouse |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-DNAH9 antibody is: synthetic peptide directed towards the C-terminal region of Human DNAH9. Synthetic peptide located within the following region: DSQARDGAGATREEKVKALLEEILERVTDEFNIPELMAKVEERTPYIVVA |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 91 kDa |
| Gene Name | dynein axonemal heavy chain 9 |
| Database Link | |
| Background | This gene encodes the heavy chain subunit of axonemal dynein, a large multi-subunit molecular motor. Axonemal dynein attaches to microtubules and hydrolyzes ATP to mediate the movement of cilia and flagella. The gene expresses at least two transcript variants; additional variants have been described, but their full length nature has not been determined. |
| Synonyms | DNAH17L; Dnahc9; DNEL1; DYH9; HL-20; HL20 |
| Note | Immunogen Sequence Homology: Dog: 100%; Human: 100%; Rat: 92%; Horse: 92%; Mouse: 92%; Pig: 83%; Bovine: 83%; Guinea pig: 83% |
| Reference Data | |
| Protein Families | Druggable Genome |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.