Glp1r Rabbit Polyclonal Antibody

CAT#: TA338011

Rabbit Polyclonal Anti-Glp1r Antibody

Product Images

Host: Rabbit; Target Name: Glp1r; Sample Tissue: Mouse Liver lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Glp1r antibody is: synthetic peptide directed towards the middle region of Mouse Glp1r. Synthetic peptide located within the following region: YRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLYIIYTV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: glucagon-like peptide 1 receptor
• Database Link:
  NP_067307
  Entrez Gene 14652 Mouse
  UniProt ID O35659
• Background: The function of this protein remains unknown.
• Synonyms: GLP-1-R; GLP-1R; MGC138331
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Pig: 93%; Guinea pig: 93%; Mouse: 86%; Sheep: 86%; Bovine: 86%; Rabbit: 86%