STARD6 Rabbit Polyclonal Antibody

CAT#: TA337906

Rabbit Polyclonal Anti-STARD6 Antibody

Product Images

WB Suggested Anti-STARD6 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-STARD6 antibody is: synthetic peptide directed towards the N-terminal region of Human STARD6. Synthetic peptide located within the following region: NRDTSGWKVVKTSKKITVSSKASRKFHGNLYRVEGIIPESPAKLSDFLYQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: StAR related lipid transfer domain containing 6
• Database Link:
  NP_631910
  Entrez Gene 147323 Human
  UniProt ID P59095
• Background: Cholesterol homeostasis is regulated, at least in part, by sterol regulatory element (SRE)-binding proteins and by liver X receptors. Upon sterol depletion, LXRs are inactive and SREBPs are cleaved, after which they bind promoter SREs and activate genes involved in cholesterol biosynthesis and uptake. Sterol transport is mediated by vesicles or by soluble protein carriers, such as steroidogenic acute regulatory protein. STAR is homologous to a family of proteins containing a 200- to 210-amino acid STAR-related lipid transfer (START) domain, including STARD6.
• Synonyms: OTTHUMP00000163555; StAR-related lipid transfer (START) domain containing 6; START domain containing 6; START domain containing protein 6
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 92%; Bovine: 92%; Rabbit: 92%; Pig: 83%; Mouse: 83%