CREG2 Rabbit Polyclonal Antibody

CAT#: TA337812

Rabbit Polyclonal Anti-CREG2 Antibody

Product Images

WB Suggested Anti-CREG2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CREG2 antibody: synthetic peptide directed towards the N terminal of human CREG2. Synthetic peptide located within the following region: VSSVSWAVTNEVDEELDSASTEEAMPALLEDSGSIWQQSFPASAHKEDAH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: cellular repressor of E1A stimulated genes 2
• Database Link:
  NP_722578
  Entrez Gene 200407 Human
  UniProt ID Q8IUH2
• Background: The exact functions of CREG2 remain unknown.
• Synonyms: cellular repressor of E1A-stimulated genes 2
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Secreted Protein