CREG2 Rabbit Polyclonal Antibody

CAT#: TA337812

Rabbit Polyclonal Anti-CREG2 Antibody


 Product Datasheet for 'TA337812'

USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CREG2 antibody: synthetic peptide directed towards the N terminal of human CREG2. Synthetic peptide located within the following region: VSSVSWAVTNEVDEELDSASTEEAMPALLEDSGSIWQQSFPASAHKEDAH
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Predicted Protein Size 32 kDa
Gene Name cellular repressor of E1A stimulated genes 2
Background The exact functions of CREG2 remain unknown.
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 93%; Guinea pig: 93%
Reference Data
Protein Families Secreted Protein
Other products for "CREG2"
Frequently bought together (2)
Transient overexpression lysate of cellular repressor of E1A-stimulated genes 2 (CREG2)
    • 100 ug

USD 315.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
40% off proteins and antibodies
68 Mouse Clones