RDH10 Rabbit Polyclonal Antibody
Frequently bought together (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Recombinant protein of human retinol dehydrogenase 10 (all-trans) (RDH10), 20 µg
USD 867.00
Other products for "RDH10"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RDH10 antibody: synthetic peptide directed towards the N terminal of human RDH10. Synthetic peptide located within the following region: QSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 38 kDa |
Gene Name | retinol dehydrogenase 10 (all-trans) |
Database Link | |
Background | RDH10 is a retinol dehydrogenase with a clear preference for NADP. RDH10 converts all-trans-retinol to all-trans-retinal. RDH10 has no detectable activity towards 11-cis-retinol, 9-cis-retinol and 13-cis-retinol.RDH10 generates all-trans retinal from all-trans retinol and may plan an important role in the photic visual cycle. All-trans retinal is isomerized to 11-cis retinal by the retinal G protein-coupled receptor (RGR; MIM 600342) when the retinal pigment epithelium (RPE) is illuminated. [supplied by OMIM] |
Synonyms | SDR16C4 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Metabolic pathways, Retinol metabolism |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.