MPP7 Rabbit Polyclonal Antibody

CAT#: TA337785

Rabbit Polyclonal Anti-MPP7 Antibody

Product Images

WB Suggested Anti-MPP7 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: HT1080 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MPP7 antibody: synthetic peptide directed towards the N terminal of human MPP7. Synthetic peptide located within the following region: MPALSTGSGSDTGLYELLAALPAQLQPHVDSQEDLTFLWDMFGEKSLHSL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: membrane palmitoylated protein 7
• Database Link:
  NP_775767
  Entrez Gene 143098 Human
  UniProt ID Q5T2T1
• Background: MPP7 acts as an important adapter that promotes epithelial cell polarity and tight junction formation via its interaction with DLG1. MPP7 is involved in the assembly of protein complexes at sites of cell-cell contact.Membrane-associated guanylate kinases (MAGUKs) are important adaptor proteins involved in the assembly of protein complexes at sites of cell-cell contact. They are found in synapses, adherens junctions, and tight junctions. All MAGUKs contain at least 1 PDZ domain, an SH3 domain, and a GUK domain, and many contain 1 or 2 L27 domains, which are involved in multimerization of MAGUKs. MPP7 belongs to the p55 stardust subfamily of MAGUKs, which is named for a Drosophila gene required for establishment of cell polarity in the developing fly embryo (Bohl et al., 2007 [PubMed 17237226]). [supplied by OMIM]
• Synonyms: RP11-218D6.5
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%

Reference Data

• Protein Families: Druggable Genome