CHCHD1 Rabbit Polyclonal Antibody

CAT#: TA337623

Rabbit Polyclonal Anti-CHCHD1 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of coiled-coil-helix-coiled-coil-helix domain containing 1 (CHCHD1)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "CHCHD1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CHCHD1 antibody: synthetic peptide directed towards the N terminal of human CHCHD1. Synthetic peptide located within the following region: MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 13
Gene Name coiled-coil-helix-coiled-coil-helix domain containing 1
Background The function of this protein remains unknown.
Synonyms C10orf34; C2360; MRP-S37
Note Immunogen Sequence Homology: Human: 100%; Dog: 86%; Goat: 86%; Bovine: 86%; Horse: 83%; Pig: 79%; Rat: 79%; Mouse: 79%; Guinea pig: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.