LAYN Rabbit Polyclonal Antibody

CAT#: TA337582

Rabbit Polyclonal Anti-LAYN Antibody

Product Images

WB Suggested Anti-LAYN Antibody Titration: 0.2-1 ug/ml; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LAYN antibody: synthetic peptide directed towards the N terminal of human LAYN. Synthetic peptide located within the following region: CYKVIYFHDTSRRLNFEEAKEACRRDGGQLVSIESEDEQKLIEKFIENLL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: layilin
• Database Link:
  NP_849156
  Entrez Gene 143903 Human
  UniProt ID Q6UX15
• Background: LAYN contains 1 C-type lectin domain. It is the receptor for hyaluronate.
• Synonyms: FLJ30977; FLJ31092
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Dog: 92%; Horse: 92%; Bovine: 91%; Rat: 86%; Pig: 85%; Guinea pig: 85%; Mouse: 79%

Reference Data

• Protein Families: Transmembrane