C10orf78 (SFR1) Rabbit Polyclonal Antibody

CAT#: TA337430

Rabbit Polyclonal Anti-SFR1 Antibody

Product Images

Host: Rabbit; Target Name: SFR1; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SFR1 antibody is: synthetic peptide directed towards the N-terminal region of Human SFR1. Synthetic peptide located within the following region: NSSRKQPMSATLRERLRKTRFSFNSSYNVVKRLKVESEENDQTFSEKPAS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: SWI5 dependent homologous recombination repair protein 1
• Database Link:
  NP_660290
  Entrez Gene 119392 Human
  UniProt ID Q86XK3
• Background: SFR1 is a component of the SWI5-SFR1 complex, a complex required for double-strand break repair via homologous recombination.
• Synonyms: bA373N18.1; C10orf78; MEI5; MEIR5
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Dog: 85%; Rat: 85%