KBTBD6 Rabbit Polyclonal Antibody

CAT#: TA337369

Rabbit Polyclonal Anti-KBTBD6 Antibody

Product Images

Host: Rabbit; Target Name: KBTBD6; Sample Tissue: Hela Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-KBTBD6 antibody is: synthetic peptide directed towards the N-terminal region of Human KBTBD6. Synthetic peptide located within the following region: QSREDAPRSRRLASPRGGKRPKKIHKPTVSAFFTGPEELKDTAHSAALLA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 76 kDa
• Gene Name: kelch repeat and BTB domain containing 6
• Database Link:
  NP_690867
  Entrez Gene 89890 Human
  UniProt ID Q86V97
• Background: The function of this protein remains unknown.
• Synonyms: DKFZp547E1912; DKFZp547M073; FLJ58260
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Pig: 86%; Bovine: 86%; Rat: 79%; Mouse: 79%; Guinea pig: 79%