ARHGAP28 Rabbit Polyclonal Antibody

CAT#: TA336131

Rabbit Polyclonal Anti-ARHGAP28 Antibody

Product Images

WB Suggested Anti-ARHGAP28 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ARHGAP28 Antibody: synthetic peptide directed towards the N terminal of human ARHGAP28. Synthetic peptide located within the following region: KEGSFAVPRSDSVAILETIPVLPVHSNGSPEPGQPVQNAISDDDFLEKNI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 63 kDa
• Gene Name: Rho GTPase activating protein 28
• Database Link:
  NP_001010000
  Entrez Gene 79822 Human
• Background: ARHGAP28 contains 1 Rho-GAP domain. ARHGAP28 is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.
• Synonyms: DKFZp686A2038; FLJ10312; FLJ27160
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%