HMGCLL1 Rabbit Polyclonal Antibody

CAT#: TA335959

Rabbit Polyclonal Anti-HMGCLL1 Antibody

Product Images

WB Suggested Anti-HMGCLL1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: OVCAR-3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-HMGCLL1 Antibody: synthetic peptide directed towards the N terminal of human HMGCLL1. Synthetic peptide located within the following region: MGNVPSAVKHCLSYQQLLREHLWIGDSVAGALDPAQETSQLSGLPEFVKI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: 3-hydroxymethyl-3-methylglutaryl-CoA lyase-like 1
• Database Link:
  NP_001035865
  Entrez Gene 54511 Human
  UniProt ID Q8TB92
• Background: HMGCLL1 is involved in the catabolism of branched amino acids such as leucine.
• Synonyms: bA418P12.1; er-cHL
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Rabbit: 100%; Rat: 92%; Mouse: 92%; Bovine: 92%