Signal peptide peptidase like 2B (SPPL2B) Rabbit Polyclonal Antibody

CAT#: TA335943

Rabbit Polyclonal Anti-SPPL2B Antibody

Product Images

WB Suggested Anti-SPPL2B Antibody Titration: 1 ug/ml; Positive Control: Jurkat cell lysate;SPPL2B is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SPPL2B Antibody: synthetic peptide directed towards the N terminal of human SPPL2B. Synthetic peptide located within the following region: VARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVAL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: signal peptide peptidase like 2B
• Database Link:
  NP_001070706
  Entrez Gene 56928 Human
  UniProt ID Q8TCT7
• Background: SPPL2B is a member of the GXGD family of aspartic proteases. The GXGD proteases are transmembrane proteins with two conserved catalytic motifs localized within the membrane-spanning regions. This enzyme localizes to endosomes, lysosomes, and the plasma membrane. It cleaves the transmembrane domain of tumor necrosis factor alpha to release the intracellular domain, which triggers cytokine expression in the innate and adaptive immunity pathways.
• Synonyms: IMP-4; IMP4; PSH4; PSL1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Guinea pig: 79%

Reference Data

• Protein Families: Protease, Transmembrane