FANCL Rabbit Polyclonal Antibody

CAT#: TA335902

Rabbit Polyclonal Anti-FANCL Antibody

Product Images

WB Suggested Anti-FANCL Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human heart

• 

  Lanes: Lane 1: 7ug HEK293 cytoplasmic lysate; 2: 7ug HEK293 nuclei lysate; Primary Antibody Dilution: 1:1000; Secondary Antibody: Anti-rabbit-HRP; Secondary Antibody Dilution: ; 1:3000; Gene Name: ; FANCL; FANCL is supported by BioGPS gene expression data to be expressed in HEK293

• 

  Rabbit Anti-FANCL Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue; Observed Staining: Cytoplasmic and nuclear in in pinealocytes; Primary Antibody Concentration: 1:100; Secondary Antibody: Donkey anti-Rabbit-Cy3; Secondary Antibody Concentration: 1:200; Magnification: 20X; Exposure Time: 0.5–2.0 sec;

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FANCL Antibody: synthetic peptide directed towards the middle region of human FANCL. Synthetic peptide located within the following region: ASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQVNSPQSSLISIY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: Fanconi anemia complementation group L
• Database Link:
  NP_001108108
  Entrez Gene 55120 Human
  UniProt ID Q9NW38
• Background: The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FAN
• Synonyms: FAAP43; PHF9; POG
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rabbit: 86%

Reference Data

• Protein Pathways: Ubiquitin mediated proteolysis