ACSBG2 Rabbit Polyclonal Antibody

CAT#: TA335873

Rabbit Polyclonal Anti-ACSBG2 Antibody

Product Images

WB Suggested Anti-ACSBG2 Antibody Titration: 0.2-1 ug/ml; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ACSBG2 Antibody: synthetic peptide directed towards the middle region of human ACSBG2. Synthetic peptide located within the following region: LNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILTGCK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 68 kDa
• Gene Name: acyl-CoA synthetase bubblegum family member 2
• Database Link:
  NP_001276106
  Entrez Gene 81616 Human
  UniProt ID Q5FVE4
• Background: ACSBG2 belongs to the ATP-dependent AMP-binding enzyme family, bubblegum subfamily.ACSBG2 mediates activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. It is able to activate long-chain fatty acids. Also able to activate very long-chain fatty acids; however, the relevance of such activity is unclear in vivo. ACSBG2 has increased ability to activate oleic and linoleic acid. It may play a role in spermatogenesis.
• Synonyms: BGR; BRGL; PRTD-NY3; PRTDNY3
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Zebrafish: 92%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Dog: 85%; Mouse: 79%