IKB beta (NFKBIB) Rabbit Polyclonal Antibody

CAT#: TA335822

Rabbit Polyclonal Anti-NFKBIB Antibody

Product Images

Lanes: ; Lane 1: 100ug mouse liver lysate; Lane 2: 100ug mouse brain lysate; Lane 3: 100ug mouse heart lysate; Lane 4: 100ug mouse kidney lysate; Lane 5: 100ug mouse lung lysate; Lane 6: 100ug mouse thymus lysate; Lane 7: 100ug mouse spleen lysate; Lane 8: 100ug mouse testis lysate; Lane 9: 100ug HeLa cell lysate; Primary Antibody Dilution: ; 1:1000; Secondary Antibody: ; Anti-rabbit-AP; Secondary Antibody Dilution: ; 1:10,000;

• 

  WB Suggested Anti-NFKBIB Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:2500; Positive Control: Jurkat cell lysate. NFKBIB is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse, Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-NFKBIB Antibody: synthetic peptide directed towards the N terminal of human NFKBIB. Synthetic peptide located within the following region: LVFGYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTAL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: NFKB inhibitor beta
• Database Link:
  NP_002494
  Entrez Gene 18036 MouseEntrez Gene 4793 Human
  UniProt ID Q15653
• Background: NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008, or NFKBIB), which inactivate NF-kappa-B by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, MIM 600664 or IKBKB, MIM 603258) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine). [supplied by OMIM]
• Synonyms: IKBB; TRIP9
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%

Reference Data

• Protein Families: Stem cell - Pluripotency, Transcription Factors
• Protein Pathways: Adipocytokine signaling pathway, B cell receptor signaling pathway, Chemokine signaling pathway, Cytosolic DNA-sensing pathway, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, RIG-I-like receptor signaling pathway, T cell receptor signaling pathway