Neuro D4 (DPF1) Rabbit Polyclonal Antibody

CAT#: TA335741

Rabbit Polyclonal Anti-DPF1 Antibody

Product Images

WB Suggested Anti-DPF1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat, Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DPF1 Antibody: synthetic peptide directed towards the middle region of human DPF1. Synthetic peptide located within the following region: KELAWVPEAQRKHTAKKAPDGTVIPNGYCDFCLGGSKKTGCPEDLISCAD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: double PHD fingers 1
• Database Link:
  NP_004638
  Entrez Gene 50545 RatEntrez Gene 8193 Human
  UniProt ID Q92782
• Background: Part of the d4 family of zinc finger proteins, DPF1 has been localized on chromosome 19.
• Synonyms: BAF45b; NEUD4; neuro-d4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors