PAX1 Rabbit Polyclonal Antibody

CAT#: TA335697

Rabbit Polyclonal Anti-PAX1 Antibody

Product Images

WB Suggested Anti-PAX1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: MCF7 cell lysate

• 

  Host: Rabbit; Target Name: PAX1; Sample Tissue: Human Fetal Muscle; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: PAX1; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PAX1 Antibody: synthetic peptide directed towards the middle region of human PAX1. Synthetic peptide located within the following region: AGVNRTAFPATPAVNGLEKPALEADIKYTQSASTLSAVGGFLPACAYPAS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: paired box 1
• Database Link:
  NP_006183
  Entrez Gene 5075 Human
  UniProt ID P15863
• Background: The PAX genes, including PAX1, are a highly conserved family of developmental control genes that encode transcription factors and have been shown to play a role in pattern formation during embryogenesis in vertebrates.The PAX genes, including PAX1, are a highly conserved family of developmental control genes that encode transcription factors and have been shown to play a role in pattern formation during embryogenesis in vertebrates (McGaughran et al., 2003 [PubMed 12774041]). See PAX7 (MIM 167410) for a discussion of paired box domain genes. [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: HUP48; OFC2
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 93%; Dog: 86%; Rabbit: 86%; Bovine: 79%