CLPB Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of ClpB caseinolytic peptidase B homolog (E. coli) (CLPB)
USD 436.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "CLPB"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-CLPB Antibody: synthetic peptide directed towards the N terminal of human CLPB. Synthetic peptide located within the following region: QGGRFDTKCLAAATWGRLPGPEETLPGQDSWNGVPSRAGLGMCALAAALV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 78 kDa |
Gene Name | ClpB homolog, mitochondrial AAA ATPase chaperonin |
Database Link | |
Background | CLPB belongs to the clpA/clpB family. It contains 4 ANK repeats. CLPB may function as a regulatory ATPase and be related to secretion/protein trafficking process. |
Synonyms | ANKCLB; HSP78; MEGCANN; MGCA7; SKD3 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Rat: 92%; Mouse: 92%; Bovine: 86%; Rabbit: 85%; Pig: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.