SLC25A31 Rabbit Polyclonal Antibody

CAT#: TA335435

Rabbit Polyclonal Anti-SLC25A31 Antibody

Product Images

WB Suggested Anti-SLC25A31 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC25A31 Antibody: synthetic peptide directed towards the N terminal of human SLC25A31. Synthetic peptide located within the following region: LAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPEARYKGMVDCLVRIP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: solute carrier family 25 member 31
• Database Link:
  NP_112581
  Entrez Gene 83447 Human
  UniProt ID Q9H0C2
• Background: Mitochondrial ADP/ATP carriers, such as SLC25A31, are nuclear-coded mitochondrial proteins that catalyze the exchange of ATP generated in mitochondria by ATP synthase (see MIM 108729) against ADP produced in cytosol by most energy-consuming reactions.Mitochondrial ADP/ATP carriers, such as SLC25A31, are nuclear-coded mitochondrial proteins that catalyze the exchange of ATP generated in mitochondria by ATP synthase (see MIM 108729) against ADP produced in cytosol by most energy-consuming reactions (Dolce et al., 2005 [PubMed 15670820]). [supplied by OMIM]
• Synonyms: AAC4; ANT 4; ANT4; SFEC35kDa
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Rabbit: 93%; Dog: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Calcium signaling pathway, Huntington's disease, Parkinson's disease