CALHM5 Rabbit Polyclonal Antibody

CAT#: TA335373

Rabbit Polyclonal Anti-FAM26E Antibody

Product Images

Host: Rabbit; Target Name: FAM26E; Sample Tissue: Fetal Lung lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FAM26E Antibody is: synthetic peptide directed towards the middle region of Human FAM26E. Synthetic peptide located within the following region: ELICKGKPKECWEELHKVSCGKTSMLPTVNEELKLSLQAQSQILGWCLIC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: family with sequence similarity 26 member E
• Database Link:
  NP_714922
  Entrez Gene 254228 Human
  UniProt ID Q8N5C1
• Background: The function of this protein remains unknown.
• Synonyms: C6orf188; dJ493F7.3
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Rabbit: 92%; Dog: 79%; Bovine: 79%

Reference Data

• Protein Families: Transmembrane