ORP8 (OSBPL8) Rabbit Polyclonal Antibody

CAT#: TA335309

Rabbit Polyclonal Anti-OSBPL8 Antibody

Product Images

WB Suggested Anti-OSBPL8 Antibody Titration: 0.2-1 ug/ml; Positive Control: OVCAR-3 cell lysate.OSBPL8 is strongly supported by BioGPS gene expression data to be expressed in OVCAR3

• 

  Host: Rabbit; Target Name: OSBPL8; Sample Tissue: OVCAR-3; Antibody Dilution: 1.0 ug/ml.OSBPL8 is strongly supported by BioGPS gene expression data to be expressed in OVCAR3

• 

  Host: Rabbit; Target Name: OSBPL8; Sample Tissue: HT1080; Antibody Dilution: 1.0 ug/ml.OSBPL8 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-OSBPL8 antibody: synthetic peptide directed towards the middle region of human OSBPL8. Synthetic peptide located within the following region: YSSPEPDIQDSSGSEAQSVKPSTRRKKGIELGDIQSSIESIKQTQEEIKR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 97 kDa
• Gene Name: oxysterol binding protein like 8
• Database Link:
  NP_001003712
  Entrez Gene 114882 Human
  UniProt ID Q9BZF1
• Background: OSBPL8 is a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, OSBPL8 contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain.
• Synonyms: MST120; MSTP120; ORP8; OSBP10
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Transmembrane