MLH1 Rabbit Polyclonal Antibody

CAT#: TA335134

Rabbit polyclonal Anti-MLH1 Antibody

Product Images

WB Suggested Anti-MLH1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Placenta

• 

  Lanes: Lane 1: hMLH1 tranfected 293 cells; Primary Antibody Dilution: ; 1:500; Secondary Antibody: ; Anti-rabbit HRP; Secondary Antibody Dilution: ; 1:5000; Gene Name: ; MLH1; Submitted by: ; Galina Petukhova, USUHS; MLH1 is supported by BioGPS gene expres

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MLH1 antibody: synthetic peptide directed towards the N terminal of human MLH1. Synthetic peptide located within the following region: MIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 84 kDa
• Gene Name: mutL homolog 1
• Database Link:
  NP_000240
  Entrez Gene 17350 MouseEntrez Gene 4292 Human
  UniProt ID P40692
• Background: This gene was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). It is a human homolog of the E. coli DNA mismatch repair gene mutL, consistent with the characteristic alterations in microsatellite sequences (RER+phenotype) found in HNPCC.This gene was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). It is a human homolog of the E. coli DNA mismatch repair gene mutL, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC. Alternatively spliced transcript variants encoding different isoforms have been described, but their full-length natures have not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: COCA2; FCC2; hMLH1; HNPCC; HNPCC2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Yeast: 83%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Colorectal cancer, Endometrial cancer, Mismatch repair, Pathways in cancer