FAM190A (CCSER1) Rabbit Polyclonal Antibody

CAT#: TA335111

Rabbit polyclonal Anti-MGC48628 Antibody

Product Images

WB Suggested Anti-MGC48628 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MGC48628 antibody: synthetic peptide directed towards the N terminal of human MGC48628. Synthetic peptide located within the following region: HHKKGSEPKQEPTNQNLSISNGAQPGHSNMQKLSLEEHIKTRGRHSVGFS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 74 kDa
• Gene Name: coiled-coil serine rich protein 1
• Database Link:
  NP_997374
  Entrez Gene 401145 Human
  UniProt ID Q9C0I3
• Background: The specific function of the protein remains unknown.
• Synonyms: FAM190A
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Guinea pig: 93%; Rabbit: 92%; Rat: 86%; Mouse: 86%; Dog: 79%