IDI1 Rabbit Polyclonal Antibody

CAT#: TA335079

Rabbit Polyclonal Anti-IDI1 Antibody

Product Images

WB Suggested Anti-IDI1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IDI1 antibody: synthetic peptide directed towards the middle region of human IDI1. Synthetic peptide located within the following region: PLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: isopentenyl-diphosphate delta isomerase 1
• Database Link:
  NP_004499
  Entrez Gene 3422 Human
  UniProt ID Q13907
• Background: IDI1 is a peroxisomally-localized enzyme that catalyzes the interconversion of isopentenyl diphosphate (IPP) to its highly electrophilic isomer, dimethylallyl diphosphate (DMAPP), which are the substrates for the successive reaction that results in the synthesis of farnesyl diphosphate and, ultimately, cholesterol. It has been shown in peroxisomal deficiency diseases such as Zellweger syndrome and neonatal adrenoleukodystrophy that there is reduction in IPP isomerase activity.IDI1 encodes a peroxisomally-localized enzyme that catalyzes the interconversion of isopentenyl diphosphate (IPP) to its highly electrophilic isomer, dimethylallyl diphosphate (DMAPP), which are the substrates for the successive reaction that results in the synthesis of farnesyl diphosphate and, ultimately, cholesterol. It has been shown in peroxisomal deficiency diseases such as Zellweger syndrome and neonatal adrenoleukodystrophy that there is reduction in IPP isomerase activity. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-492 BE891119.1 50-541 493-1758 BX648472.1 1201-2466 1759-2150 BX537663.1 4550-4941
• Synonyms: IPP1; IPPI1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Horse: 86%

Reference Data

• Protein Pathways: Metabolic pathways, Terpenoid backbone biosynthesis