C17orf104 (MEIOC) Rabbit Polyclonal Antibody

CAT#: TA334967

Rabbit Polyclonal Anti-C17orf104 Antibody

Product Images

WB Suggested Anti-C17orf104 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: HT1080 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C17orf104 antibody: synthetic peptide directed towards the C terminal of human C17orf104. Synthetic peptide located within the following region: LHIRLEECCEQWRALEKERKKTELALAKNYPGKKVSSTNNTPVPRLTSNP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 71 kDa
• Gene Name: meiosis specific with coiled-coil domain
• Database Link:
  NP_001028831
  Entrez Gene 284071 Human
  UniProt ID A2RUB1
• Background: The specific function of C17orf104 is not yet known.
• Synonyms: MGC43301
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%