RAD26L (ERCC6L2) Rabbit Polyclonal Antibody

CAT#: TA334929

Rabbit Polyclonal Anti-ERCC6L2 Antibody

Product Images

Host: Rabbit; Target Name: ERCC6L2; Sample Tissue: HT1080 Whole cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ERCC6L2 antibody is: synthetic peptide directed towards the C-terminal region of Human ERCC6L2. Synthetic peptide located within the following region: RDKVLLFSFSTKLLDVLQQYCMASGLDYRRLDGSTKSEERLKIVKEFNST
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: ERCC excision repair 6 like 2
• Database Link:
  CAB97543
  Entrez Gene 375748 Human
  UniProt ID Q5T890
• Background: The function of this protein remains unknown.
• Synonyms: 0610007P08Rik; 1700019D06Rik; 9330134C04Rik; Rad26l; Sr278
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Dog: 92%; Zebrafish: 77%