SUPT5H Rabbit Polyclonal Antibody

CAT#: TA334735

Rabbit Polyclonal Anti-SUPT5H Antibody

Product Images

WB Suggested Anti-SUPT5H Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SUPT5H antibody: synthetic peptide directed towards the middle region of human SUPT5H. Synthetic peptide located within the following region: FEDQPEGIDLEVVTESTGKEREHNFQPGDNVEVCEGELINLQGKILSVDG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 121 kDa
• Gene Name: SPT5 homolog, DSIF elongation factor subunit
• Database Link:
  NP_003160
  Entrez Gene 6829 Human
  UniProt ID O00267
• Background: SUPT5H and its binding partner regulate transcriptional elongation by RNA polymerase II. SPT4 and SPT5 are involved in both 5,6-dichloro-1-beta-D-ribofuranosylbenzimidazole (DRB)-mediated transcriptional inhibition and the activation of transcriptional elongation by the human immunodeficiency virus type 1 (HIV-1) Tat protein.
• Synonyms: SPT5; SPT5H; Tat-CT1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Transcription Factors