KIFC2 Rabbit Polyclonal Antibody

CAT#: TA334705

Rabbit Polyclonal Anti-KIFC2 Antibody

Product Images

WB Suggested Anti-KIFC2 Antibody Titration: 1.25 ug/ml; Positive Control: Jurkat cell lysate

• 

  Human Muscle

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KIFC2 antibody: synthetic peptide directed towards the N terminal of human KIFC2. Synthetic peptide located within the following region: VRPPSPDGSTSQEESPSHFTAVPGEPLGDETQGQQPLQLEEDQRAWQRLE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 90 kDa
• Gene Name: kinesin family member C2
• Database Link:
  NP_665697
  Entrez Gene 90990 Human
  UniProt ID Q96AC6
• Background: Members of the kinesin superfamily of microtubule-associated proteins are involved in a variety of intracellular processes including cell division and organelle transport. KIFC2 encodes a 792 amino acid protein, which contains the conserved motor domain at the C-terminal end of the protein and is most similar to members of the KAR3 family involved in cell division.
• Synonyms: kinesin family member C2
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 86%; Bovine: 86%; Mouse: 79%

Reference Data

• Protein Families: Druggable Genome