Kinesin 5A (KIF5A) Rabbit Polyclonal Antibody

CAT#: TA334674

Rabbit Polyclonal Anti-KIF5A Antibody

Product Images

WB Suggested Anti-KIF5A Antibody Titration: 0.2-1 ug/ml; Positive Control: Human brain

• 

  Rabbit Anti-KIF5A antibody; Paraffin Embedded Tissue: Human Lung cell Cellular Data: bronchiole epithelium of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KIF5A antibody: synthetic peptide directed towards the middle region of human KIF5A. Synthetic peptide located within the following region: LEESYDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALELQMESH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 117 kDa
• Gene Name: kinesin family member 5A
• Database Link:
  NP_004975
  Entrez Gene 3798 Human
  UniProt ID Q12840
• Background: KIF5A is a member of the kinesin family of proteins. Members of this family are part of a multisubunit complex that functions as a microtubule motor in intracellular organelle transport. Mutations in this gene cause autosomal dominant spastic paraplegia 10.
• Synonyms: D12S1889; MY050; NKHC; SPG10
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 86%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome