IGFBPL1 Rabbit Polyclonal Antibody

CAT#: TA334311

Rabbit Polyclonal Anti-IGFBPL1 Antibody

Product Images

Host: Rabbit; Target Name: IGFBPL1; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IGFBPL1 antibody is: synthetic peptide directed towards the C-terminal region of Human IGFBPL1. Synthetic peptide located within the following region: WRKVTKSPEGTQALEELPGDHVNIAVQVRGGPSDHEATAWILINPLRKED
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: insulin like growth factor binding protein-like 1
• Database Link:
  NP_001007564
  Entrez Gene 347252 Human
  UniProt ID Q8WX77
• Background: IGF-binding proteins prolong the half-life of IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs in cell culture. They alter the interaction of IGFs with their cell surface receptors. IGFBPL1 may be a putative tumor suppressor protein.
• Synonyms: bA113O24.1; IGFBP-RP4; IGFBPRP4
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Horse: 86%; Dog: 79%; Bovine: 79%; Rabbit: 79%