PARP11 Rabbit Polyclonal Antibody

CAT#: TA334267

Rabbit Polyclonal Anti-PARP11 Antibody

Product Images

WB Suggested Anti-PARP11 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysateKIF3B is supported by BioGPS gene expression data to be expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PARP11 antibody: synthetic peptide directed towards the N terminal of human PARP11. Synthetic peptide located within the following region: SAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: poly(ADP-ribose) polymerase family member 11
• Database Link:
  NP_065100
  Entrez Gene 57097 Human
  UniProt ID Q9NR21
• Background: The PARP11 gene is part of the poly (ADP-ribose) polymerase family.
• Synonyms: ARTD11; C12orf6; MIB006
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 93%; Mouse: 91%; Rat: 79%