PARP16 Rabbit Polyclonal Antibody

CAT#: TA334257

Rabbit Polyclonal Anti-PARP16 Antibody

Product Images

WB Suggested Anti-PARP16 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: 293T cell lysatePARP16 is supported by BioGPS gene expression data to be expressed in HEK293T

• 

  Host: Rabbit; Target Name: PARP16; Sample Tissue: 293T; Antibody Dilution: 1.0 ug/ml; PARP16 is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PARP16 antibody: synthetic peptide directed towards the middle region of human PARP16. Synthetic peptide located within the following region: PKYFVVTNNQLLRVKYLLVYSQKPPKSRASSQLSWFSSHWFTVMISLYLL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: poly(ADP-ribose) polymerase family member 16
• Database Link:
  NP_060321
  Entrez Gene 54956 Human
  UniProt ID Q8N5Y8
• Background: Poly(ADP-ribosyl)ation is an immediate DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells. PARP16 is a member of poly(ADP-ribose) polymerases (PARPs) family that is encoded by different genes and displaying a conserved catalytic domain in which PARP-1 (113 kDa), the founding member, and PARP-2 (62 kDa) are so far the sole enzymes whose catalytic activity has been shown to be immediately stimulated by DNA strand breaks. A large repertoire of sequences encoding novel PARPs now extends considerably the field of poly(ADP-ribosyl)ation reactions to various aspects of the cell biology including cell proliferation and cell death. Some of these new members interact with each other, share common partners and common subcellular localizations suggesting possible fine tuning in the regulation of this post-translational modification of proteins.
• Synonyms: ARTD15; C15orf30; pART15
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Rabbit: 86%; Pig: 80%; Bovine: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Transmembrane