USP3 Rabbit Polyclonal Antibody

CAT#: TA334221

Rabbit Polyclonal Anti-USP3 Antibody

Product Images

WB Suggested Anti-USP3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: Jurkat cell lysateUSP3 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-USP3 antibody: synthetic peptide directed towards the middle region of human USP3. Synthetic peptide located within the following region: IEQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDNNVSLVEEFRKTLCAL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 59 kDa
• Gene Name: ubiquitin specific peptidase 3
• Database Link:
  NP_006528
  Entrez Gene 9960 Human
  UniProt ID Q9Y6I4
• Background: USP3 is a novel human ubiquitin-specific protease. The USP3 protein is a functional ubiquitin-specific protease in vitro, and is able to inhibit ubiquitin-dependent degradation of both an N-end Rule substrate and abnormal endogenous proteins in yeast. USP3 is also only the second known ubiquitin-specific protease capable of efficiently cleaving a ubiquitin-proline bond.
• Synonyms: SIH003; UBP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 86%; Guinea pig: 86%; Zebrafish: 85%

Reference Data

• Protein Families: Druggable Genome, Protease