Spt6 (SUPT6H) Rabbit Polyclonal Antibody

CAT#: TA334032

Rabbit Polyclonal Anti-SUPT6H Antibody

Product Images

Host: Rabbit; Target Name: SUPT6H; Sample Tissue: Lung Tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SUPT6H Antibody is: synthetic peptide directed towards the N-terminal region of Human SUPT6H. Synthetic peptide located within the following region: FVESEAEESEEEYNDEGEVVPRVTKKFVEEEDDDEEEEEENLDDQDEQGN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 79 kDa
• Gene Name: SPT6 homolog, histone chaperone
• Database Link:
  NP_003161
  Entrez Gene 6830 Human
  UniProt ID Q7KZ85
• Background: SUPT6H acts to stimulate transcriptional elongation by RNA polymerase II.
• Synonyms: emb-5; SPT6; SPT6H
• Note: Immunogen sequence homology: Bovine: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 90%

Reference Data

• Protein Families: Transcription Factors