TEF Rabbit Polyclonal Antibody

CAT#: TA334022

Rabbit Polyclonal Anti-TEF Antibody

Product Images

WB Suggested Anti-TEF Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TEF Antibody: synthetic peptide directed towards the middle region of human TEF. Synthetic peptide located within the following region: RKDEGRKEAAEGKEQGLAPLVVQTDSASPLGAGHLPGLAFSSHLHGQQFF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: TEF, PAR bZIP transcription factor
• Database Link:
  NP_003207
  Entrez Gene 7008 Human
  UniProt ID Q10587
• Background: TEF (thyrotroph embryonic factor) is a member of the PAR bZip (proline and acidic amino acid-rich basic leucine zipper) transcription factor family. It accumulates with robust circadian rhythms in tissues with high amplitudes of clock gene expression. Thyrotroph embryonic factor (TEF), a transcription factor, is a member of the PAR (proline and acidic amino acid-rich) subfamily of basic region/leucine zipper (bZIP) transcription factors. It is expressed in a broad range of cells and tissues in adult animals, however, during embryonic development, TEF expression appears to be restricted to the developing anterior pituitary gland, coincident with the appearance of thyroid-stimulating hormone, beta (TSHB). Indeed, TEF can bind to, and transactivate the TSHB promoter. It shows homology (in the functional domains) with other members of the PAR-bZIP subfamily of transcription factors, which include albumin D box-binding protein (DBP), human hepatic leukemia factor (HLF) and chicken vitellogenin gene-binding protein (VBP); VBP is considered the chicken homologue of TEF. Different members of the subfamily can readily form heterodimers, and share DNA-binding, and transcriptional regulatory properties.
• Synonyms: KIAA1655
• Note: Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Rat: 92%; Mouse: 92%; Sheep: 92%; Bovine: 92%; Rabbit: 85%

Reference Data

• Protein Families: Transcription Factors