LAT3 (SLC43A1) Rabbit Polyclonal Antibody

CAT#: TA333992

Rabbit Polyclonal Anti-SLC43A1 Antibody

Product Images

WB Suggested Anti-SLC43A1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Placenta

• 

  2Hum. Fetal Liver; Host: Rabbit; Target Name: FAM46C; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC43A1 Antibody: synthetic peptide directed towards the middle region of human SLC43A1. Synthetic peptide located within the following region: AVNKMLEYLVTGGQEHETNEQQQKVAETVGFYSSVFGAMQLLCLLTCPLI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: solute carrier family 43 member 1
• Database Link:
  NP_003618
  Entrez Gene 8501 Human
  UniProt ID O75387
• Background: SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids.SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids (Babu et al., 2003 [PubMed 12930836]). [supplied by OMIM]
• Synonyms: LAT3; PB39; POV1; R00504
• Note: Immunogen sequence homology: Human: 100%; Rat: 79%; Mouse: 79%

Reference Data

• Protein Families: Transmembrane