SLC35D2 Rabbit Polyclonal Antibody

CAT#: TA333899

Rabbit Polyclonal Anti-SLC35D2 Antibody

Product Images

WB Suggested Anti-SLC35D2 Antibody; Titration: 1.0 ug/ml; Positive Control: Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC35D2 Antibody is: synthetic peptide directed towards the C-terminal region of Human SLC35D2. Synthetic peptide located within the following region: LIGGDYIFSLLNFVGLNICMAGGLRYSFLTLSSQLKPKPVGEENICLDLK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: solute carrier family 35 member D2
• Database Link:
  NP_008932
  Entrez Gene 11046 Human
  UniProt ID Q76EJ3
• Background: Nucleotide sugars, which are synthesized in the cytosol or the nucleus, are high-energy donor substrates for glycosyltransferases located in the lumen of the endoplasmic reticulum and Golgi apparatus. Translocation of nucleotide sugars from the cytosol into the lumen compartment is mediated by specific nucleotide sugar transporters, such as SLC35D2.
• Synonyms: hfrc; HFRC1; SQV7L; UGTrel8
• Note: Immunogen sequence homology: Human: 100%; Pig: 87%; Mouse: 86%; Bovine: 80%

Reference Data

• Protein Families: Transmembrane