RAP1GAP2 Rabbit Polyclonal Antibody

CAT#: TA333850

Rabbit Polyclonal Anti-RAP1GAP2 Antibody

Product Images

Host: Rabbit; Target Name: RAP1GAP2; Sample Tissue: HCT15 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml; RAP1GAP2 is supported by BioGPS gene expression data to be expressed in HCT15

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RAP1GAP2 Antibody is: synthetic peptide directed towards the N-terminal region of Human RAP1GAP2. Synthetic peptide located within the following region: MLEKMQGIKLEEQKPGPQKNKDDYIPYPSIDEVVEKGGPYPQVILPQFGG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 80 kDa
• Gene Name: RAP1 GTPase activating protein 2
• Database Link:
  NP_055900
  Entrez Gene 23108 Human
  UniProt ID Q684P5
• Background: This gene encodes a GTPase-activating protein that activates the small guanine-nucleotide-binding protein Rap1 in platelets. The protein interacts with synaptotagmin-like protein 1 and Rab27 and regulates secretion of dense granules from platelets at sites of endothelial damage. Multiple transcript variants encoding different isoforms have been found for this gene.
• Synonyms: GARNL4; RAP1GA3
• Note: Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Guinea pig: 93%