Glutathione S Transferase kappa 1 (GSTK1) Rabbit Polyclonal Antibody

CAT#: TA333788

Rabbit Polyclonal Anti-GSTK1 Antibody

Product Images

WB Suggested Anti-GSTK1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GSTK1 Antibody: synthetic peptide directed towards the N terminal of human GSTK1. Synthetic peptide located within the following region: NLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: glutathione S-transferase kappa 1
• Database Link:
  NP_057001
  Entrez Gene 373156 Human
  UniProt ID Q9Y2Q3
• Background: GSTK1 is a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. GSTK1 is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells.
• Synonyms: GST; GST13; GST 13-13; GST13-13; GSTK1-1; hGSTK1
• Note: Immunogen sequence homology: Human: 100%; Horse: 93%; Dog: 86%; Pig: 85%; Guinea pig: 85%; Rat: 79%

Reference Data

• Protein Pathways: Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450