SYDE2 Rabbit Polyclonal Antibody

CAT#: TA333620

Rabbit Polyclonal Anti-SYDE2 Antibody

Product Images

Host: Rabbit; Target Name: SYDE2; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 1.0 ug/ml.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SYDE2 Antibody is: synthetic peptide directed towards the C-terminal region of Human SYDE2. Synthetic peptide located within the following region: KENLNDVDYDDVPSEDRKIGENYSKMDGPEVMIEQPIPMSKECTFQTYLT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 133 kDa
• Gene Name: synapse defective Rho GTPase homolog 2
• Database Link:
  NP_115560
  Entrez Gene 84144 Human
  UniProt ID Q5VT97
• Background: SYDE2 is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.
• Synonyms: RP11-33E12.1
• Note: Immunogen sequence homology: Human: 100%; Dog: 85%; Bovine: 85%