HYLS1 Rabbit Polyclonal Antibody

SKU TA333506

Rabbit Polyclonal Anti-HYLS1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-HYLS1 Antibody: synthetic peptide directed towards the middle region of human HYLS1. Synthetic peptide located within the following region: YFEYKRDWDSIRLPGEDHRKELRWGVREQMLCRAEPQSKPQHIYVPNNYL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 34 kDa
• Gene Name: HYLS1, centriolar and ciliogenesis associated
• Database Link:
  NP_659451
  Q96M11
• Background: This protein is a protein localized to the cytoplasm. Mutations in this protein are associated with hydrolethalus syndrome.
• Synonyms: HLS
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Bovine: 93%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Horse: 86%; Mouse: 86%; Rabbit: 86%

Reference Data