Glycerol kinase (GK) Rabbit Polyclonal Antibody

CAT#: TA333323

Rabbit Polyclonal Anti-GK Antibody

Product Images

WB Suggested Anti-GK Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: U937 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GK Antibody: synthetic peptide directed towards the middle region of human GK. Synthetic peptide located within the following region: MAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: glycerol kinase
• Database Link:
  NP_976325
  Entrez Gene 2710 Human
  UniProt ID P32189
• Background: The product of this gene belongs to the FGGY kinase family of proteins and encodes glycerol kinase. Glycerol kinase is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Defects in this gene are the cause of glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been identified.
• Synonyms: GK1; GKD
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Glycerolipid metabolism, Metabolic pathways, PPAR signaling pathway