Fbxo47 Rabbit Polyclonal Antibody

CAT#: TA332215

Rabbit Polyclonal Anti-Fbxo47 Antibody

Product Images

Host: Rabbit; Target Name: Fbxo47; Sample Tissue: Mouse Liver lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Fbxo47 Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Fbxo47. Synthetic peptide located within the following region: FACVTMEMLQPVMSGDRDDDDRGFLNLFHLLHAQANFHKEVLYLTMNAIS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: F-box protein 47
• Database Link:
  NP_001074904
  Entrez Gene 72973 Mouse
  UniProt ID A2A6H3
• Background: Fbxo47 probably recognizes and binds to some phosphorylated proteins and promotes their ubiquitination and degradation.
• Synonyms: FBXO47
• Note: Immunogen sequence homology: Human: 100%; Rabbit: 100%; Dog: 93%; Horse: 93%; Mouse: 77%; Bovine: 77%