Cyp4f17 Rabbit Polyclonal Antibody

CAT#: TA332201

Rabbit Polyclonal Anti-Cyp4f17 Antibody

Product Images

Host: Rabbit; Target Name: Cyp4f17; Sample Tissue: Mouse Kidney lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Cyp4f17 Antibody is: synthetic peptide directed towards the middle region of Mouse Cyp4f17. Synthetic peptide located within the following region: DVLLLSKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWILYNLARHPE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: cytochrome P450, family 4, subfamily f, polypeptide 17
• Database Link:
  NP_001094915
  Entrez Gene 208285 Mouse
• Background: The function of this protein remains unknown.
• Synonyms: EG208285
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Sheep: 93%