LIN54 Rabbit Polyclonal Antibody

CAT#: TA332193

Rabbit Polyclonal Anti-LIN54 Antibody

Product Images

Host: Rabbit; Target Name: LIN54; Sample Tissue: HT1080 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LIN54 Antibody is: synthetic peptide directed towards the C-terminal region of Human LIN54. Synthetic peptide located within the following region: NPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSIC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: lin-54 DREAM MuvB core complex component
• Database Link:
  NP_001108479
  Entrez Gene 132660 Human
  UniProt ID Q6MZP7
• Background: LIN54 is a component of the LIN, or DREAM, complex, an essential regulator of cell cycle genes.
• Synonyms: CXCDC1; JC8.6; MIP120; TCX1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%