H2BW2 Rabbit Polyclonal Antibody

CAT#: TA332166

Rabbit Polyclonal Anti-H2BFM Antibody

Product Images

Host: Rabbit; Target Name: H2BFM; Sample Tissue: Fetal Brain lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-H2BFM Antibody is: synthetic peptide directed towards the middle region of Human H2BFM. Synthetic peptide located within the following region: SCYLMAAASAMAEASSETTSEEGQSIQEPKEANSTKAQKQKRRGCRGSR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: H2B histone family member M
• Database Link:
  NP_001157888
  Entrez Gene 286436 Human
  UniProt ID P0C1H6
• Background: H2BFM is a core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
• Synonyms: 1700014N06Rik; H2bfw; H2bl2; RP23-389M3.2
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Pathways: Systemic lupus erythematosus