CHRAC1 Rabbit Polyclonal Antibody

CAT#: TA331896

Rabbit Polyclonal Anti-CHRAC1 Antibody

Product Images

WB Suggested Anti-CHRAC1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CHRAC1 Antibody: synthetic peptide directed towards the N terminal of human CHRAC1. Synthetic peptide located within the following region: SINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 15 kDa
• Gene Name: chromatin accessibility complex 1
• Database Link:
  NP_059140
  Entrez Gene 54108 Human
  UniProt ID Q9NRG0
• Background: CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging. CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging. [supplied by OMIM]
• Synonyms: CHARC1; CHARC15; CHRAC-1; CHRAC-15; CHRAC15; YCL1
• Note: Immunogen sequence homology: Human: 100%; Rat: 92%; Horse: 92%; Bovine: 92%; Dog: 85%; Pig: 85%; Mouse: 85%; Guinea pig: 85%