DENND4C Rabbit Polyclonal Antibody
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "DENND4C"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-DENND4C Antibody is: synthetic peptide directed towards the C-terminal region of Human DENND4C. Synthetic peptide located within the following region: KHNQIITEETGSAVEPSDEIKRASGDVQTMKISSVPNSLSKRNVSLTRSH |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 87 kDa |
Gene Name | DENN domain containing 4C |
Database Link | |
Background | DENND4C is guanine nucleotide exchange factor (GEF) activating RAB10. It promotes the exchange of GDP to GTP, converting inactive GDP-bound RAB10 into its active GTP-bound form. Thereby, stimulates SLC2A4/GLUT4 glucose transporter-enriched vesicles delivery to the plasma membrane in response to insulin. |
Synonyms | bA513M16.3; C9orf55; C9orf55B; RAB10GEF |
Note | Immunogen sequence homology: Human: 100%; Dog: 86%; Horse: 85%; Bovine: 85%; Rabbit: 83%; Pig: 79%; Guinea pig: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.