DENND4C Rabbit Polyclonal Antibody

CAT#: TA331875

Rabbit Polyclonal Anti-DENND4C Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "DENND4C"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-DENND4C Antibody is: synthetic peptide directed towards the C-terminal region of Human DENND4C. Synthetic peptide located within the following region: KHNQIITEETGSAVEPSDEIKRASGDVQTMKISSVPNSLSKRNVSLTRSH
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 87 kDa
Gene Name DENN domain containing 4C
Background DENND4C is guanine nucleotide exchange factor (GEF) activating RAB10. It promotes the exchange of GDP to GTP, converting inactive GDP-bound RAB10 into its active GTP-bound form. Thereby, stimulates SLC2A4/GLUT4 glucose transporter-enriched vesicles delivery to the plasma membrane in response to insulin.
Synonyms bA513M16.3; C9orf55; C9orf55B; RAB10GEF
Note Immunogen sequence homology: Human: 100%; Dog: 86%; Horse: 85%; Bovine: 85%; Rabbit: 83%; Pig: 79%; Guinea pig: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.