HROB Rabbit Polyclonal Antibody

CAT#: TA331754

Rabbit Polyclonal Anti-C17orf53 Antibody

Product Images

Host: Rabbit; Target Name: C17orf53; Sample Tissue: MCF7 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-C17orf53 Antibody is: synthetic peptide directed towards the N-terminal region of Human C17orf53. Synthetic peptide located within the following region: EVLRETARPQSSALHPLLTFESQQQQVGGFEGPEQDEFDKVLASMELEEP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: chromosome 17 open reading frame 53
• Database Link:
  NP_076937
  Entrez Gene 78995 Human
  UniProt ID Q8N3J3
• Background: The function of this protein remains unknown.
• Synonyms: FLJ11594; MGC3130
• Note: Immunogen sequence homology: Pig: 100%; Human: 100%; Bovine: 93%; Dog: 92%; Horse: 86%